PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00010995-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family EIL
Protein Properties Length: 618aa    MW: 70224.5 Da    PI: 5.264
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00010995-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3518.92.2e-158484251353
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         +el++rmw+d+m+lkrlke++k     ke  ++ +k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+L
  WALNUT_00010995-RA  48 DELERRMWRDKMRLKRLKEQNKC----KEG-IDMAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNL 133
                         79*****************9996....788.9*********************************************************** PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
                EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                         r+WWk+kv+fdrngpaai+kyqa+n+i+++++++++    ++h+l+elqDTtlgSLLsalmqhcdppqrrfplek+v+pPWWPtG+e+ww+
  WALNUT_00010995-RA 134 REWWKDKVRFDRNGPAAITKYQADNAIPGKNDGCNS-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKAVPPPWWPTGNEDWWP 223
                         **********************************88.9***************************************************** PP

                         HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX...XXXXX CS
                EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss...slrkq 270
                         +lgl+kdqg+ppykkphdlkkawkv+vLtavikh+sp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee ++++++++s    s+  +
  WALNUT_00010995-RA 224 QLGLPKDQGPPPYKKPHDLKKAWKVGVLTAVIKHISPDIAKIRKLVRQSKCLQDKMTAKESATWLAIINQEETLARELYPDSCpplSSGGG 314
                         *********************************************************************************444456666* PP

                         XXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX..............................XXXXXXXXXXXXXXXXXXXXX......XX CS
                EIN3 271 spkvtlsceqkedvegkkeskikhvqavktta..............................gfpvvrkrkkkpsesakvsskevsrtcqs 331
                         s ++++++ +++dveg +++   +v ++k ++                              ++++++krk+ ++ + +v++k  ++tc+ 
  WALNUT_00010995-RA 315 SGSLVINDCSEYDVEGAEDEPNFDVPEQKPENlhlssmgmermrerlsvqqppypfkgesitNLDFIQKRKASSDLNVIVEQK--IYTCEF 403
                         ***************776666699*****999***************************************766666666665..6***** PP

                         XXXXX.XXXXXXXXXXXXXXXX CS
                EIN3 332 sqfrgsetelifadknsisqne 353
                          q+++se++l+f+d++s+++++
  WALNUT_00010995-RA 404 LQCPYSEVRLGFHDRTSRDNHQ 425
                         ********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048735.1E-12948295No hitNo description
Gene3DG3DSA:1.10.3180.101.5E-75168305IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.29E-61174298IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 618 aa     Download sequence    Send to blast
MMMFEDMGLC SDMDFIFAPV GGGEAAALPP EPEAMMDDDY TDEEVDVDEL ERRMWRDKMR  60
LKRLKEQNKC KEGIDMAKQR QSQEQARRKK MSRAQDGILK YMLKMMEVCK AQGFVYGIIP  120
EKGKPVTGAS DNLREWWKDK VRFDRNGPAA ITKYQADNAI PGKNDGCNSI GPTPHTLQEL  180
QDTTLGSLLS ALMQHCDPPQ RRFPLEKAVP PPWWPTGNED WWPQLGLPKD QGPPPYKKPH  240
DLKKAWKVGV LTAVIKHISP DIAKIRKLVR QSKCLQDKMT AKESATWLAI INQEETLARE  300
LYPDSCPPLS SGGGSGSLVI NDCSEYDVEG AEDEPNFDVP EQKPENLHLS SMGMERMRER  360
LSVQQPPYPF KGESITNLDF IQKRKASSDL NVIVEQKIYT CEFLQCPYSE VRLGFHDRTS  420
RDNHQLTCPY RSPSEFGGSN IHVNEVKPII FPQSFVQPKP APPSVNSTQP SFELSGLGVP  480
EDGQKMISEL MSIYDTNIQG NRNLISSNKA VIENQNLHQL KNQPQQDIYF HGEGVVMEGK  540
FFEESNTHSC HQMFTHEESQ FDRFKVPNSP FETNHGNNNL QMMFGSPFDL ASFDYKEDLQ  600
GVALDTLPKQ PDISIWYQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A5e-851733052134Protein ETHYLENE INSENSITIVE 3
4zds_B5e-851733052134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00367DAPTransfer from AT3G20770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007016682.10.0Ethylene insensitive 3 family protein
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0R5PAD20.0A0A0R5PAD2_CARPA; Ethylene insensitive 3-like 1
STRINGGLYMA13G03700.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein